What is the catalog number for Human YWHAQ protein?

The catalog number for Human YWHAQ protein is orb54319.

What sizes are available for Human YWHAQ protein?

Human YWHAQ protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human YWHAQ protein come in?

Human YWHAQ protein is available in 3 different pack sizes.

Is Human YWHAQ protein in stock?

Human YWHAQ protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human YWHAQ protein

This Human YWHAQ protein spans the amino acid sequence from region 1-245aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

14-3-3 protein T-cell 14-3-3 protein tau Protein HS1

UniProt

P27348

Expression Region

1-245aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-250AA: 1-245AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN