Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human YWHAQ protein

This Human YWHAQ protein spans the amino acid sequence from region 1-245aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

14-3-3 protein T-cell 14-3-3 protein tau Protein HS1

UniProt

P27348

Expression Region

1-245aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-250AA: 1-245AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM25 Antibody
24571 100 µL

TRIM25 Antibody

Sign In for Pricing
View Details
pCDH-CMV-MXI1-1-3xFLAG-EF1-copGFP Plasmid
PVT20738 2 µg

pCDH-CMV-MXI1-1-3xFLAG-EF1-copGFP Plasmid

Sign In for Pricing
View Details
Crb3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7166506 1.0 µg DNA

Crb3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Azetidine-2-carboxylic acid
MBS5758925 Inquire

Azetidine-2-carboxylic acid

Sign In for Pricing
View Details
GDF9 sgRNA CRISPR Lentivector (Human) (Target 2)
K0849903 1.0 µg DNA

GDF9 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Leukocyte-associated immunoglobulin-like receptor 1
AP85490 1 mg

Leukocyte-associated immunoglobulin-like receptor 1

Sign In for Pricing
View Details