Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GBA3 protein

This Human GBA3 protein spans the amino acid sequence from region 1-162aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytosolic beta-glucosidase-like protein 1

UniProt

Q9H227

Expression Region

1-162aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-190AA: 1-162AAFull Length : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAFPAGFGWAAATAAYQVEGGWDADGKGPCVWDTFTHQGGERVFKNQTGDVACGSYTLWEEDLKCIKQLGLTHYRFSLSWSRLLPDGTTGFINQKAIQLDKVNLQVYCAWSLLDNFEWNQGYSSRFGLFHVDFEDPARPRVPYTSAKEYAKIIRNNGLEAHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPATA1 Protein Vector (Human) (pPB-C-His)
PV039725 500 ng

SPATA1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
MFSD2B Recombinant Protein (Mouse)
RP150440 100 µg

MFSD2B Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Dengue virus type 3 (strain Sri Lanka/1266/2000) (DENV-3) DENV-3 NS1/Non-structural recombinant protein
PX-P6463-100 100 µg

Dengue virus type 3 (strain Sri Lanka/1266/2000) (DENV-3) DENV-3 NS1/Non-structural recombinant protein

Sign In for Pricing
View Details
IQGAP3 (Ras GTPase-activating-like Protein IQGAP3, MGC10170, MGC10831, MGC1947)
128566 100 µg

IQGAP3 (Ras GTPase-activating-like Protein IQGAP3, MGC10170, MGC10831, MGC1947)

Sign In for Pricing
View Details
ZNF665 Antibody
orb1243025 100 µL

ZNF665 Antibody

Sign In for Pricing
View Details
Delta-9-Tetrahydrocannabivarinic acid
FT172553-01 1 mg

Delta-9-Tetrahydrocannabivarinic acid

Sign In for Pricing
View Details