Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ATG10 protein

This Human ATG10 protein spans the amino acid sequence from region 1-220aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Autophagy-related protein 10

UniProt

Q9H0Y0

Expression Region

1-220aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-117AA: 1-220AAFull Length of BC042363 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/XFD700 Anti-non-human primates/ human CD170 Antibody *1A5*
117001O1-AAT 100 Tests

PE/XFD700 Anti-non-human primates/ human CD170 Antibody *1A5*

Sign In for Pricing
View Details
SOCS4 Rabbit pAb
E45R27889N 50 ul

SOCS4 Rabbit pAb

Sign In for Pricing
View Details
Rat BMP Binding Endothelial Regulator (BMPER) ELISA Kit
MBS2706711-01 24 Strip Well

Rat BMP Binding Endothelial Regulator (BMPER) ELISA Kit

Sign In for Pricing
View Details
Rat BMP Binding Endothelial Regulator (BMPER) ELISA Kit
MBS2706711-02 48 Well

Rat BMP Binding Endothelial Regulator (BMPER) ELISA Kit

Sign In for Pricing
View Details
Rat BMP Binding Endothelial Regulator (BMPER) ELISA Kit
MBS2706711-03 96 Well

Rat BMP Binding Endothelial Regulator (BMPER) ELISA Kit

Sign In for Pricing
View Details
Rat BMP Binding Endothelial Regulator (BMPER) ELISA Kit
MBS2706711-04 5x 96 Well

Rat BMP Binding Endothelial Regulator (BMPER) ELISA Kit

Sign In for Pricing
View Details