Human NEDD8 protein
This Human NEDD8 protein spans the amino acid sequence from region 1-81aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Neddylin Neural precursor cell expressed developmentally down-regulated protein 8
UniProt
Q15843
Expression Region
1-81aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
35.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-345AA: 1-81AAFull Length of BC026101 : Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
026533-01 48 Tests
Lipase, Lipoprotein (LIPD) BioAssayTM ELISA Kit (Human)
Sign In for Pricing
View Details 026533-02 96 Tests
Lipase, Lipoprotein (LIPD) BioAssayTM ELISA Kit (Human)
Sign In for Pricing
View Details 
MBS1456328-01 0.02 mg (E-Coli)
Recombinant Vibrio cholerae serotype O1 Regulator of ribonuclease activity A (rraA)
Sign In for Pricing
View Details MBS1456328-02 0.1 mg (E-Coli)
Recombinant Vibrio cholerae serotype O1 Regulator of ribonuclease activity A (rraA)
Sign In for Pricing
View Details MBS1456328-03 0.02 mg (Yeast)
Recombinant Vibrio cholerae serotype O1 Regulator of ribonuclease activity A (rraA)
Sign In for Pricing
View Details MBS1456328-04 0.1 mg (Yeast)
Recombinant Vibrio cholerae serotype O1 Regulator of ribonuclease activity A (rraA)
Sign In for Pricing
View Details