Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ARG1 protein

This Human ARG1 protein spans the amino acid sequence from region 1-322aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Liver-type arginase Type I arginase

UniProt

P05089

Expression Region

1-322aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal GST-tagged1747-1905AA: 1-322AACytoplasmic Domain: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2D3 (NM_181893) Human Over-expression Lysate
LY405581 100 µg

UBE2D3 (NM_181893) Human Over-expression Lysate

Sign In for Pricing
View Details
Cyp4b1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6830002 1.0 µg DNA

Cyp4b1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Ttc22 (NM_177667) Mouse Tagged ORF Clone Lentiviral Particle
MR220481L4V 200 µL

Ttc22 (NM_177667) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AdmiRa-hsa-miR-15b-5p-Off Virus
mh5227 1.0 mL

AdmiRa-hsa-miR-15b-5p-Off Virus

Sign In for Pricing
View Details
Serpin I2 (SERPINI2) Antibody
abx237754 100 µg

Serpin I2 (SERPINI2) Antibody

Sign In for Pricing
View Details
Mrgpra5 siRNA Oligos set (Mouse)
30400174 3x 5 nmol

Mrgpra5 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details