Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ARG1 protein

This Human ARG1 protein spans the amino acid sequence from region 1-322aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Liver-type arginase Type I arginase

UniProt

P05089

Expression Region

1-322aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal GST-tagged1747-1905AA: 1-322AACytoplasmic Domain: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM29 Protein Vector (Mouse) (pPB-N-His)
PV152319 500 ng

ADAM29 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
CDC5L (Cell Division Cycle 5-Like, CDC5, CEF1, PCDC5RP, CDC5-Like, dJ319D22.1) (HRP)
MBS6410704-01 0.1 mL

CDC5L (Cell Division Cycle 5-Like, CDC5, CEF1, PCDC5RP, CDC5-Like, dJ319D22.1) (HRP)

Sign In for Pricing
View Details
CDC5L (Cell Division Cycle 5-Like, CDC5, CEF1, PCDC5RP, CDC5-Like, dJ319D22.1) (HRP)
MBS6410704-02 5x 0.1 mL

CDC5L (Cell Division Cycle 5-Like, CDC5, CEF1, PCDC5RP, CDC5-Like, dJ319D22.1) (HRP)

Sign In for Pricing
View Details
5430427O19Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
10792114 3x 1.0 µg

5430427O19Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
STAG3L1 ORF Vector (Human) (pORF)
45669011 1.0 µg DNA

STAG3L1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
TSC1, phosphorylated (Y304) (TSC1, KIAA0243, TSC, Hamartin, Tuberous sclerosis 1 protein) (FITC) discontinued
043335-FITC 200 µL

TSC1, phosphorylated (Y304) (TSC1, KIAA0243, TSC, Hamartin, Tuberous sclerosis 1 protein) (FITC) discontinued

Sign In for Pricing
View Details