Human Angiotensinogen protein

Aangiotensinogen (serpin peptidase inhibitor clade A member 8) Proteins, AGT Proteins, AI265500 Proteins, Alpha 1 antiproteinase antitrypsin Proteins, Ang Proteins, Ang I Proteins, Ang II Proteins, Ang III Proteins, AngII Proteins, Angiotensin I Proteins, Angiotensin II Proteins, Angiotensin III Proteins, Angiotensin-3 Proteins, Angiotensinogen (PAT) Proteins, Angiotensinogen Proteins, ANGT_HUMAN Proteins, ANHU Proteins, ANRT Proteins, AT-2 Proteins, AT-II Proteins, Des-Asp[1]-angiotensin II Proteins, FLJ92595 Proteins, FLJ97926 Proteins, MGC105326 Proteins, PAT Proteins, Pre angiotensinogen Proteins, Serine (or cysteine) proteinase inhibitor Proteins, Serpin A8 Proteins, Serpin peptidase inhibitor clade A member 8 Proteins, SERPINA8 Proteins

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

VIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNS