Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Angiotensinogen protein

This Human Angiotensinogen protein spans the amino acid sequence from region 44-427aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aangiotensinogen (serpin peptidase inhibitor clade A member 8) Proteins, AGT Proteins, AI265500 Proteins, Alpha 1 antiproteinase antitrypsin Proteins, Ang Proteins, Ang I Proteins, Ang II Proteins, Ang III Proteins, AngII Proteins, Angiotensin I Proteins, Angiotensin II Proteins, Angiotensin III Proteins, Angiotensin-3 Proteins, Angiotensinogen (PAT) Proteins, Angiotensinogen Proteins, ANGT_HUMAN Proteins, ANHU Proteins, ANRT Proteins, AT-2 Proteins, AT-II Proteins, Des-Asp[1]-angiotensin II Proteins, FLJ92595 Proteins, FLJ97926 Proteins, MGC105326 Proteins, PAT Proteins, Pre angiotensinogen Proteins, Serine (or cysteine) proteinase inhibitor Proteins, Serpin A8 Proteins, Serpin peptidase inhibitor clade A member 8 Proteins, SERPINA8 Proteins

UniProt

P01019

Expression Region

44-427aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 44-427AASequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse TLR2 ELISA Kit
SEKM-0163-01 48 Tests

Mouse TLR2 ELISA Kit

Sign In for Pricing
View Details
Mouse TLR2 ELISA Kit
SEKM-0163-02 96 Tests

Mouse TLR2 ELISA Kit

Sign In for Pricing
View Details
XCL1 Polyclonal Antibody
E-AB-67754-01 60 µL

XCL1 Polyclonal Antibody

Sign In for Pricing
View Details
XCL1 Polyclonal Antibody
E-AB-67754-02 120 µL

XCL1 Polyclonal Antibody

Sign In for Pricing
View Details
XCL1 Polyclonal Antibody
E-AB-67754-03 200 µL

XCL1 Polyclonal Antibody

Sign In for Pricing
View Details
DSCR4-IT1 Protein Vector (Human) (pPB-N-His)
PV074150 500 ng

DSCR4-IT1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details