Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep IL4 protein

This Sheep IL4 protein spans the amino acid sequence from region 25-135aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell stimulatory factor 1

UniProt

P30368

Expression Region

25-135aa

Tag

N-terminal 10XHis-B2M-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 10xHis-B2M-tagged and C-terminal Myc-taggedExpression Region: 25-135aaSequence Info: Full Length of MatureProtein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Semaphorin 4B (SEMA4B) ELISA Kit
MBS2023059-01 24 Strip Well

Human Semaphorin 4B (SEMA4B) ELISA Kit

Sign In for Pricing
View Details
Human Semaphorin 4B (SEMA4B) ELISA Kit
MBS2023059-02 48 Well

Human Semaphorin 4B (SEMA4B) ELISA Kit

Sign In for Pricing
View Details
Human Semaphorin 4B (SEMA4B) ELISA Kit
MBS2023059-03 96 Well

Human Semaphorin 4B (SEMA4B) ELISA Kit

Sign In for Pricing
View Details
Human Semaphorin 4B (SEMA4B) ELISA Kit
MBS2023059-04 5x 96 Well

Human Semaphorin 4B (SEMA4B) ELISA Kit

Sign In for Pricing
View Details
Human Semaphorin 4B (SEMA4B) ELISA Kit
MBS2023059-05 10x 96 Well

Human Semaphorin 4B (SEMA4B) ELISA Kit

Sign In for Pricing
View Details
RSPH6A Antibody Blocking Peptide
orb1508854 500 µg

RSPH6A Antibody Blocking Peptide

Sign In for Pricing
View Details