Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep IL4 protein

This Sheep IL4 protein spans the amino acid sequence from region 25-135aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell stimulatory factor 1

UniProt

P30368

Expression Region

25-135aa

Tag

N-terminal 10XHis-B2M-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 10xHis-B2M-tagged and C-terminal Myc-taggedExpression Region: 25-135aaSequence Info: Full Length of MatureProtein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmed1 Rat Pre-designed siRNA Set A
HY-RS25731 1 Set

Tmed1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
NET1 Rabbit pAb, IRDye 800CW conjugated
orb2880102 100 µL

NET1 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
SIRT1 Immunizing Peptide
orb737627 100 µg

SIRT1 Immunizing Peptide

Sign In for Pricing
View Details
Anti-Zic1 Antibody (9N686)
TMAC-04319-01 50 μL

Anti-Zic1 Antibody (9N686)

Sign In for Pricing
View Details
Anti-Zic1 Antibody (9N686)
TMAC-04319-02 100 µL

Anti-Zic1 Antibody (9N686)

Sign In for Pricing
View Details
OBP-801
BO180923-01 10 mg

OBP-801

Sign In for Pricing
View Details