What is the catalog number for Bovine IFNW1 protein?

The catalog number for Bovine IFNW1 protein is orb8187.

What sizes are available for Bovine IFNW1 protein?

Bovine IFNW1 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Bovine IFNW1 protein come in?

Bovine IFNW1 protein is available in 3 different pack sizes.

Is Bovine IFNW1 protein in stock?

Bovine IFNW1 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Bovine IFNW1 protein

This Bovine IFNW1 protein spans the amino acid sequence from region 24-195aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFN-omega-c1 Interferon alpha-II-1

UniProt

P07352

Expression Region

24-195aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 24-195aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CDLSPNHVLVGRQNLRLLGQMRRLSPRFCLQDRKDFAFPQEMVEVSQFQEAQAISVLHEMLQQSFNLFHKERSSAAWDTTLLEQLLTGLHQQLDDLDACLGLLTGEEDSALGRTGPTLAMKRYFQGIHVYLQEKGYSDCAWEIVRLEIMRSLSSSTSLQERLRMMDGDLKSP