Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial Invasin protein

This Bacterial Invasin protein spans the amino acid sequence from region 651-835aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Invasin

UniProt

P19196

Expression Region

651-835aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Yersinia enterocolitica

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 651-835aaSequence Info: Partial Glycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VNGEQFATDKGFPKTTFNKATFQLVMNDDVANNTQYDWTSSYAASAPVDNQGKVNIAYKTYGSTVTVTAKSKKFPSYTATYQFKPNLWVFSGTMSLQSSVEASRNCQRTDFTALIESARASNGSRSPDGTLWGEWGSLATYDSAEWPSGNYWTKKTSTDFVTMDMTTGDIPTSAATAYPLCAEPQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human BMP-3
P1155-.5 500 µg

Recombinant Human BMP-3

Sign In for Pricing
View Details
FUS Antibody (HRP)
orb239311-01 50 µg

FUS Antibody (HRP)

Sign In for Pricing
View Details
FUS Antibody (HRP)
orb239311-02 100 µg

FUS Antibody (HRP)

Sign In for Pricing
View Details
TUBGCP4 Rabbit Polyclonal Antibody (HRP)
orb2082227 100 µL

TUBGCP4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Prealbumin, ID (Transthyretin, TTR, TBPA, TTR, ATTR, PALB) (AP)
MBS6494204-01 0.2 mL

Prealbumin, ID (Transthyretin, TTR, TBPA, TTR, ATTR, PALB) (AP)

Sign In for Pricing
View Details
Prealbumin, ID (Transthyretin, TTR, TBPA, TTR, ATTR, PALB) (AP)
MBS6494204-02 5x 0.2 mL

Prealbumin, ID (Transthyretin, TTR, TBPA, TTR, ATTR, PALB) (AP)

Sign In for Pricing
View Details