Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial Invasin protein

This Bacterial Invasin protein spans the amino acid sequence from region 651-835aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Invasin

UniProt

P19196

Expression Region

651-835aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Yersinia enterocolitica

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 651-835aaSequence Info: Partial Glycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VNGEQFATDKGFPKTTFNKATFQLVMNDDVANNTQYDWTSSYAASAPVDNQGKVNIAYKTYGSTVTVTAKSKKFPSYTATYQFKPNLWVFSGTMSLQSSVEASRNCQRTDFTALIESARASNGSRSPDGTLWGEWGSLATYDSAEWPSGNYWTKKTSTDFVTMDMTTGDIPTSAATAYPLCAEPQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Innovative Grade US Origin Porcine Eye with Optic Nerve and Arteries Fresh in PBS
IGPCEYONARP 1 Each

Innovative Grade US Origin Porcine Eye with Optic Nerve and Arteries Fresh in PBS

Sign In for Pricing
View Details
MLC1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-7115R-BF488 100 µL

MLC1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
XKRX Protein Vector (Mouse) (pPM-C-HA)
50530024 500 ng

XKRX Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Olfr1402 Recombinant Protein (Mouse)
RP156929 100 µg

Olfr1402 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
PTP1B (PTPN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D10]
TA503310AM 100 µL

PTP1B (PTPN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D10]

Sign In for Pricing
View Details
NDUFB10 Conjugated Antibody
orb1617396 100 µL

NDUFB10 Conjugated Antibody

Sign In for Pricing
View Details