Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish Parvalbumin beta-1 protein

This Fish Parvalbumin beta-1 protein spans the amino acid sequence from region 2-109aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen, The c 1

UniProt

Q90YK8

Expression Region

2-109aa

Tag

N-terminal 10xHis-sumo-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Theragra chalcogramma (Alaska pollock) (Gadus chalcogrammus)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 10xHis-sumo-tagged and C-terminal Myc-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SFAGVLADADVKAALAGCAAADSFNYKTFFKACGLAAKSHEEVKKAFFVIDQDQSGFIEEDELKLFLQTFGAGARELTAAETKAFLAAGDEDGDGMIGVDEFVTLVKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIOX2/MINA53 Rabbit mAb (AMR11714N)
AMR11714N-01 50 µL

RIOX2/MINA53 Rabbit mAb (AMR11714N)

Sign In for Pricing
View Details
RIOX2/MINA53 Rabbit mAb (AMR11714N)
AMR11714N-02 100 µL

RIOX2/MINA53 Rabbit mAb (AMR11714N)

Sign In for Pricing
View Details
RIOX2/MINA53 Rabbit mAb (AMR11714N)
AMR11714N-03 200 µL

RIOX2/MINA53 Rabbit mAb (AMR11714N)

Sign In for Pricing
View Details
Mouse IRS1 ELISA Kit
E056766 1 Each

Mouse IRS1 ELISA Kit

Sign In for Pricing
View Details
Rat PLASMA in Sodium EDTA
OORA01306-100ML 100 mL

Rat PLASMA in Sodium EDTA

Sign In for Pricing
View Details
PAGE3 Protein Vector (Human) (pPM-C-His)
PV109513 500 ng

PAGE3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details