Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish Parvalbumin beta-1 protein

This Fish Parvalbumin beta-1 protein spans the amino acid sequence from region 2-109aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen, The c 1

UniProt

Q90YK8

Expression Region

2-109aa

Tag

N-terminal 10xHis-sumo-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Theragra chalcogramma (Alaska pollock) (Gadus chalcogrammus)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 10xHis-sumo-tagged and C-terminal Myc-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SFAGVLADADVKAALAGCAAADSFNYKTFFKACGLAAKSHEEVKKAFFVIDQDQSGFIEEDELKLFLQTFGAGARELTAAETKAFLAAGDEDGDGMIGVDEFVTLVKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleolar protein 14 Rabbit Polyclonal Antibody (Biotin)
orb454224 100 µL

Nucleolar protein 14 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Dichloroacetaldehyde Diethyl Acetal
TRC-D431725-1G 1 g

Dichloroacetaldehyde Diethyl Acetal

Sign In for Pricing
View Details
PHETA1 (NM_144671) Human Over-expression Lysate
LS144717 100 µg

PHETA1 (NM_144671) Human Over-expression Lysate

Sign In for Pricing
View Details
FAIM3 siRNA (Human)
MBS8227324-01 15 nmol

FAIM3 siRNA (Human)

Sign In for Pricing
View Details
FAIM3 siRNA (Human)
MBS8227324-02 30 nmol

FAIM3 siRNA (Human)

Sign In for Pricing
View Details
FAIM3 siRNA (Human)
MBS8227324-03 5x 30 nmol

FAIM3 siRNA (Human)

Sign In for Pricing
View Details