Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish Parvalbumin beta-1 protein

This Fish Parvalbumin beta-1 protein spans the amino acid sequence from region 2-109aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen, The c 1

UniProt

Q90YK8

Expression Region

2-109aa

Tag

N-terminal 10xHis-sumo-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Theragra chalcogramma (Alaska pollock) (Gadus chalcogrammus)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 10xHis-sumo-tagged and C-terminal Myc-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SFAGVLADADVKAALAGCAAADSFNYKTFFKACGLAAKSHEEVKKAFFVIDQDQSGFIEEDELKLFLQTFGAGARELTAAETKAFLAAGDEDGDGMIGVDEFVTLVKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gcm1 antibody - N-terminal region (ARP36863_P050)
ARP36863_P050 100 µL

Gcm1 antibody - N-terminal region (ARP36863_P050)

Sign In for Pricing
View Details
Low control Human Serum
MBS5316734-01 10 mL

Low control Human Serum

Sign In for Pricing
View Details
Low control Human Serum
MBS5316734-02 5x 10 mL

Low control Human Serum

Sign In for Pricing
View Details
S100a5 (NM_011312) Mouse Tagged ORF Clone Lentiviral Particle
MR219065L3V 200 µL

S100a5 (NM_011312) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit anti-CEP135 Antibody, Affinity Purified
A302-250A-T 10 µg

Rabbit anti-CEP135 Antibody, Affinity Purified

Sign In for Pricing
View Details
SGA360
TRC-S282200-250MG 250 mg

SGA360

Sign In for Pricing
View Details