Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish Parvalbumin beta-1 protein

This Fish Parvalbumin beta-1 protein spans the amino acid sequence from region 2-109aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen, The c 1

UniProt

Q90YK8

Expression Region

2-109aa

Tag

N-terminal 10xHis-sumo-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Theragra chalcogramma (Alaska pollock) (Gadus chalcogrammus)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 10xHis-sumo-tagged and C-terminal Myc-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SFAGVLADADVKAALAGCAAADSFNYKTFFKACGLAAKSHEEVKKAFFVIDQDQSGFIEEDELKLFLQTFGAGARELTAAETKAFLAAGDEDGDGMIGVDEFVTLVKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RNF170 Protein - (Dry Ice)
H00081790-P01-10ug 10 µg

Recombinant Human RNF170 Protein - (Dry Ice)

Sign In for Pricing
View Details
Anti-Trx-Tag antibody
STJ96920 200 µl

Anti-Trx-Tag antibody

Sign In for Pricing
View Details
Neuromedin B (NMB) (NM_205858) Human 3' UTR Clone
SC201515 10 µg

Neuromedin B (NMB) (NM_205858) Human 3' UTR Clone

Sign In for Pricing
View Details
Bik sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4988202 1.0 µg DNA

Bik sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
p53 Transcription Factor Activity Assay Kit
K923-100 100 Assays

p53 Transcription Factor Activity Assay Kit

Sign In for Pricing
View Details
Canine 1,3 Disphosphoglycerate ELISA kit
GTR10412892 96 Well

Canine 1,3 Disphosphoglycerate ELISA kit

Sign In for Pricing
View Details