Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Scgb3a2 protein

This Mouse Scgb3a2 protein spans the amino acid sequence from region 22-139aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pneumo secretory protein 1

UniProt

Q920H1

Expression Region

22-139aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-GST-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Hydroxy-2-methyl isoborneol discontinued
279275-01 1 mg

6-Hydroxy-2-methyl isoborneol discontinued

Sign In for Pricing
View Details
6-Hydroxy-2-methyl isoborneol discontinued
279275-02 2 mg

6-Hydroxy-2-methyl isoborneol discontinued

Sign In for Pricing
View Details
6-Hydroxy-2-methyl isoborneol discontinued
279275-03 5 mg

6-Hydroxy-2-methyl isoborneol discontinued

Sign In for Pricing
View Details
6-Hydroxy-2-methyl isoborneol discontinued
279275-04 10 mg

6-Hydroxy-2-methyl isoborneol discontinued

Sign In for Pricing
View Details
6-Hydroxy-2-methyl isoborneol discontinued
279275-05 25 mg

6-Hydroxy-2-methyl isoborneol discontinued

Sign In for Pricing
View Details
Anti-PIAS2 Rabbit Monoclonal Antibody
MBS1757386-01 0.03 mL

Anti-PIAS2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details