Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect alpha 1 Antitrypsin protein

This Insect alpha 1 Antitrypsin protein spans the amino acid sequence from region 1-174aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Anti A1Aprotein, anti A1ATprotein, anti AATprotein, anti Alpha 1 antitrypsinprotein, anti Alpha1ATprotein, anti Dom1protein, anti PI1protein, anti PRO2275protein, anti Serpin A1protein, anti Serpin A1aprotein, anti Serpina1protein, anti Short peptide from AATprotein, anti SPAATprotein, anti Spi1-1protein

UniProt

P80681

Expression Region

1-174aa

Tag

N-terminal 10xHis-B2M-JD-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Tenebrio molitor (Yellow mealworm beetle)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 10xHis-B2M-JD-tagged and C-terminal Myc-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLVGAPATLSTAPIAYGGYGGYGAYGGSLLRAAPIARVASPLAYAAPVARVAAPLAYAAPYARAAVAAPVAVAKTVVADEYDPNPQYSFGYDVQDGLTGDSKNQVESRSGDVVQGSYSLVDPDGTRRTVEYTADPINGFNAVVHREPLVAKAVVAAPAIAKVHAPLAYSGGYLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SKIL Antibody
CSB-PA932063-01 50 μL

SKIL Antibody

Sign In for Pricing
View Details
SKIL Antibody
CSB-PA932063-02 100 µL

SKIL Antibody

Sign In for Pricing
View Details
MtgA Antibody
orb822145 2 mg

MtgA Antibody

Sign In for Pricing
View Details
Human Osteoprotegerin (OPG) ELISA Kit
MBS267842-01 48 Well

Human Osteoprotegerin (OPG) ELISA Kit

Sign In for Pricing
View Details
Human Osteoprotegerin (OPG) ELISA Kit
MBS267842-02 96 Well

Human Osteoprotegerin (OPG) ELISA Kit

Sign In for Pricing
View Details
Human Osteoprotegerin (OPG) ELISA Kit
MBS267842-03 5x 96 Well

Human Osteoprotegerin (OPG) ELISA Kit

Sign In for Pricing
View Details