Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Reg1 protein

This Mouse Reg1 protein spans the amino acid sequence from region 22-165aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Islet of Langerhans regenerating protein 1 Short name, REG 1 Pancreatic stone protein 1 Short name, PSP Pancreatic thread protein 1 Short name, PTP Regenerating protein 1

UniProt

P43137

Expression Region

22-165aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trp53bp1 (BC035206) Mouse Recombinant Protein
TP511448 20 µg

Trp53bp1 (BC035206) Mouse Recombinant Protein

Sign In for Pricing
View Details
SYMPK siRNA (Human)
MBS8219153-01 15 nmol

SYMPK siRNA (Human)

Sign In for Pricing
View Details
SYMPK siRNA (Human)
MBS8219153-02 30 nmol

SYMPK siRNA (Human)

Sign In for Pricing
View Details
SYMPK siRNA (Human)
MBS8219153-03 5x 30 nmol

SYMPK siRNA (Human)

Sign In for Pricing
View Details
ATF4 Adenovirus (Human)
12610051 1.0 mL

ATF4 Adenovirus (Human)

Sign In for Pricing
View Details
C.I. Disperse blue 79
T85967-01 10 mg

C.I. Disperse blue 79

Sign In for Pricing
View Details