Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Reg1 protein

This Mouse Reg1 protein spans the amino acid sequence from region 22-165aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Islet of Langerhans regenerating protein 1 Short name, REG 1 Pancreatic stone protein 1 Short name, PSP Pancreatic thread protein 1 Short name, PTP Regenerating protein 1

UniProt

P43137

Expression Region

22-165aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPRX1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
47397111 3x 1.0 µg

TPRX1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Human POMT2 Protein - (Dry Ice)
H00029954-P01-10ug 10 µg

Recombinant Human POMT2 Protein - (Dry Ice)

Sign In for Pricing
View Details
BamHI, recombinant
R0136S 10000 Units

BamHI, recombinant

Sign In for Pricing
View Details
Anti-CDHR5 Antibody
CQA7235-01 30 µL

Anti-CDHR5 Antibody

Sign In for Pricing
View Details
Anti-CDHR5 Antibody
CQA7235-02 50 μL

Anti-CDHR5 Antibody

Sign In for Pricing
View Details
Anti-CDHR5 Antibody
CQA7235-03 100 µL

Anti-CDHR5 Antibody

Sign In for Pricing
View Details