Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Pectate lyase 1 protein

This Plant Pectate lyase 1 protein spans the amino acid sequence from region 26-398aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Antigen Amb a I Antigen E Short name, AgE

UniProt

P27760

Expression Region

26-398aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Ambrosia artemisiifolia (Short ragweed)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEDVEEFLPSANETRRSLKACEAHNIIDKCWRCKADWANNRQALADCAQGFAKGTYGGKHGDVYTVTSDKDDDVANPKEGTLRFAAAQNRPLWIIFKRNMVIHLNQELVVNSDKTIDGRGVKVNIVNAGLTLMNVKNIIIHNINIHDIKVCPGGMIKSNDGPPILRQQSDGDAINVAGSSQIWIDHCSLSKASDGLLDITLGSSHVTVSNCKFTQHQFVLLLGADDTHYQDKGMLATVAFNMFTDHVDQRMPRCRFGFFQVVNNNYDRWGTYAIGGSSAPTILSQGNRFFAPDDIIKKNVLARTGTGNAESMSWNWRTDRDLLENGAIFLPSGSDPVLTPEQKAGMIPAEPGEAVLRLTSSAGVLSCHQGAPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Urinary bladder
CS505382 5x 5 µm

Frozen Tissue Sections, Urinary bladder

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS803120 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Recombinant TOP1 Antibody
RC-006-01 50 μL

Recombinant TOP1 Antibody

Sign In for Pricing
View Details
Recombinant TOP1 Antibody
RC-006-02 100 µL

Recombinant TOP1 Antibody

Sign In for Pricing
View Details
Recombinant TOP1 Antibody
RC-006-03 1 mL

Recombinant TOP1 Antibody

Sign In for Pricing
View Details
RBPMS Antibody
KC-2815-01 50 μL

RBPMS Antibody

Sign In for Pricing
View Details