Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect U1-cyrtautoxin-As1c protein

This Insect U1-cyrtautoxin-As1c protein spans the amino acid sequence from region 1-76aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aptotoxin VI Aptotoxin-6 Paralytic peptide VI Short name, PP VI

UniProt

P49270

Expression Region

1-76aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Apomastus schlingeri

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EIPQNLGSGIPHDKIKLPNGQWCKTPGDLCSSSSECCKAKHSNSVTYASFCSRQWSGQQALFINQCRTCNVESSMC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdc25B Rabbit Polyclonal Antibody (FITC)
orb7705 100 µL

Cdc25B Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
UPP1 Over-expression Lysate Product
GWB-71C950 0.1 mg

UPP1 Over-expression Lysate Product

Sign In for Pricing
View Details
Il17rc sgRNA CRISPR Lentivector set (Mouse)
K3879701 3x 1.0 µg

Il17rc sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
δ-Dystrobrevin (h3) : 293 Lysate
sc-177159 100 µg - 200 µL

δ-Dystrobrevin (h3) : 293 Lysate

Sign In for Pricing
View Details
Epor sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4445108 1.0 µg DNA

Epor sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Recombinant Shigella Sonnei rbsA Protein (aa 1-501)
VAng-0053Lsx-500gEcoli 500 µg (E. coli)

Recombinant Shigella Sonnei rbsA Protein (aa 1-501)

Sign In for Pricing
View Details