Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect U1-cyrtautoxin-As1c protein

This Insect U1-cyrtautoxin-As1c protein spans the amino acid sequence from region 1-76aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aptotoxin VI Aptotoxin-6 Paralytic peptide VI Short name, PP VI

UniProt

P49270

Expression Region

1-76aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Apomastus schlingeri

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EIPQNLGSGIPHDKIKLPNGQWCKTPGDLCSSSSECCKAKHSNSVTYASFCSRQWSGQQALFINQCRTCNVESSMC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-MEK4 (Thr261) Polyclonal Antibody, RBITC Conjugated
bs-3693R-RBITC 100 µL

Phospho-MEK4 (Thr261) Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Pitx3 Lentiviral Activation Particles (m2)
sc-422254-LAC-2 200 µL

Pitx3 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Rabbit Anti-CD36 antibody
SL1100R-01 50 µL

Rabbit Anti-CD36 antibody

Sign In for Pricing
View Details
Rabbit Anti-CD36 antibody
SL1100R-02 100 µL

Rabbit Anti-CD36 antibody

Sign In for Pricing
View Details
Peroxiredoxin 2 (PRDX2) (NM_181738) Human Recombinant Protein
E45H37605M5 20 µg

Peroxiredoxin 2 (PRDX2) (NM_181738) Human Recombinant Protein

Sign In for Pricing
View Details
NDP (Norrin, Norrie Disease Protein, X-linked Exudative Vitreoretinopathy 2 Protein, ND, EVR2, FEVR) (MaxLight 550)
MBS6428461-01 0.1 mL

NDP (Norrin, Norrie Disease Protein, X-linked Exudative Vitreoretinopathy 2 Protein, ND, EVR2, FEVR) (MaxLight 550)

Sign In for Pricing
View Details