Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect U1-cyrtautoxin-As1c protein

This Insect U1-cyrtautoxin-As1c protein spans the amino acid sequence from region 1-76aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aptotoxin VI Aptotoxin-6 Paralytic peptide VI Short name, PP VI

UniProt

P49270

Expression Region

1-76aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Apomastus schlingeri

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EIPQNLGSGIPHDKIKLPNGQWCKTPGDLCSSSSECCKAKHSNSVTYASFCSRQWSGQQALFINQCRTCNVESSMC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PEX13 Antibody [DyLight 680]
NBP2-97247FR 0.1 mL

Rabbit Polyclonal PEX13 Antibody [DyLight 680]

Sign In for Pricing
View Details
FMOD CRISPRa sgRNA lentivector (set of three targets)(Rat)
20703126 3x 1.0µg DNA

FMOD CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Rabbit anti-Synechococcus elongatus (strain PCC 7942)(Anacystis nidulans R2) RSMA Polyclonal Antibody
MBS7193288 Inquire

Rabbit anti-Synechococcus elongatus (strain PCC 7942)(Anacystis nidulans R2) RSMA Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Chlamydophila Trachomatis trpF Protein (aa 1-208) (strain D/UW-3/Cx)
VAng-Lsx7324-1mgEcoli 1 mg (E. coli)

Recombinant Chlamydophila Trachomatis trpF Protein (aa 1-208) (strain D/UW-3/Cx)

Sign In for Pricing
View Details
Tctex1D1 Lentiviral Activation Particles (h2)
sc-416449-LAC-2 200 µL

Tctex1D1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
BLMH Human shRNA Plasmid Kit (Locus ID 642)
TR314470 1 Kit

BLMH Human shRNA Plasmid Kit (Locus ID 642)

Sign In for Pricing
View Details