Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial hns protein

This Bacterial hns protein spans the amino acid sequence from region 2-135aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone-like protein HLP-II

UniProt

P18955

Expression Region

2-135aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Serratia marcescens

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SERLKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDSQAQAEIEERTRKLQQYREMLIADGIDPNELLQTMAANKAAGKAKRARRPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pomp sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3461908 1.0 µg DNA

Pomp sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Rabbit Monoclonal MDR1/ABCB1 Antibody (MDR1/8986R) [DyLight 594]
NBP3-24231DL594 0.1 mL

Rabbit Monoclonal MDR1/ABCB1 Antibody (MDR1/8986R) [DyLight 594]

Sign In for Pricing
View Details
CYP11A1 Antibody
MBS7125387-01 0.05 mL

CYP11A1 Antibody

Sign In for Pricing
View Details
CYP11A1 Antibody
MBS7125387-02 0.1 mL

CYP11A1 Antibody

Sign In for Pricing
View Details
CYP11A1 Antibody
MBS7125387-03 5x 0.1 mL

CYP11A1 Antibody

Sign In for Pricing
View Details
Recombinant Human TNF Receptor Associated Factor 4 (TRAF4)
RPU44056-01 50 µg

Recombinant Human TNF Receptor Associated Factor 4 (TRAF4)

Sign In for Pricing
View Details