Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human VPREB1 protein

This Human VPREB1 protein spans the amino acid sequence from region 20-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD179 antigen-like family member A Protein VPreB1 V (pre) B protein Short name, VpreB protein CD_antigen, CD179a

UniProt

P12018

Expression Region

20-145aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPTAARTRVP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galectin-3 Antibody / LGALS3
V4349SAF-100UG 100 µg

Galectin-3 Antibody / LGALS3

Sign In for Pricing
View Details
Crisaborole Impurity 2
RM-C181902-01 10 mg

Crisaborole Impurity 2

Sign In for Pricing
View Details
Crisaborole Impurity 2
RM-C181902-02 25 mg

Crisaborole Impurity 2

Sign In for Pricing
View Details
Crisaborole Impurity 2
RM-C181902-03 50 mg

Crisaborole Impurity 2

Sign In for Pricing
View Details
Crisaborole Impurity 2
RM-C181902-04 100 mg

Crisaborole Impurity 2

Sign In for Pricing
View Details
CEACAM1 (Carcinoembryonic antigen-Related Cell Adhesion Molecule 1 (biliary Glycoprotein), BGP, BGP1, BGPI) (MaxLight 750)
MBS6237648-01 0.1 mL

CEACAM1 (Carcinoembryonic antigen-Related Cell Adhesion Molecule 1 (biliary Glycoprotein), BGP, BGP1, BGPI) (MaxLight 750)

Sign In for Pricing
View Details