Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PALM protein

This Human PALM protein spans the amino acid sequence from region 1-384aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Paralemmin

UniProt

O75781

Expression Region

1-384aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEVLAAETTSQQERLQAIAEKRKRQAEIENKRRQLEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLLEDSVSRLEKEIEVLERGDSAPATAKENAAAPSPVRAPAPSPAKEERKTEVVMNSQQTPVGTPKDKRVSNTPLRTVDGSPMMKAAMYSVEITVEKDKVTGETRVLSSTTLLPRQPLPLGIKVYEDETKVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLSEAGSTAGAAETRGAVEGAARTTPSRREITGVQAQPGEATSGPPGIQPGQEPPVTMIFMGYQNVEDEAETKKVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEPPTEAASREENQAGPEATTSDPQDLDMKKHRCKCC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFIH1 Polyclonal Antibody
MBS2555146-01 0.06 mL

IFIH1 Polyclonal Antibody

Sign In for Pricing
View Details
IFIH1 Polyclonal Antibody
MBS2555146-02 0.12 mL

IFIH1 Polyclonal Antibody

Sign In for Pricing
View Details
IFIH1 Polyclonal Antibody
MBS2555146-03 0.2 mL

IFIH1 Polyclonal Antibody

Sign In for Pricing
View Details
IFIH1 Polyclonal Antibody
MBS2555146-04 5x 0.2 mL

IFIH1 Polyclonal Antibody

Sign In for Pricing
View Details
Hormad1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6691008 1.0 µg DNA

Hormad1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Gm14351 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
21846154 3x 1.0 µg DNA

Gm14351 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details