Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PALM protein

This Human PALM protein spans the amino acid sequence from region 1-384aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Paralemmin

UniProt

O75781

Expression Region

1-384aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEVLAAETTSQQERLQAIAEKRKRQAEIENKRRQLEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLLEDSVSRLEKEIEVLERGDSAPATAKENAAAPSPVRAPAPSPAKEERKTEVVMNSQQTPVGTPKDKRVSNTPLRTVDGSPMMKAAMYSVEITVEKDKVTGETRVLSSTTLLPRQPLPLGIKVYEDETKVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLSEAGSTAGAAETRGAVEGAARTTPSRREITGVQAQPGEATSGPPGIQPGQEPPVTMIFMGYQNVEDEAETKKVLGLQDTITAELVVIEDAAEPKEPAPPNGSAAEPPTEAASREENQAGPEATTSDPQDLDMKKHRCKCC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) ELISA Kit
MBS459447-01 48 Tests

Human Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) ELISA Kit

Sign In for Pricing
View Details
Human Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) ELISA Kit
MBS459447-02 96 Tests

Human Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) ELISA Kit

Sign In for Pricing
View Details
Human Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) ELISA Kit
MBS459447-03 5x 96 Tests

Human Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) ELISA Kit

Sign In for Pricing
View Details
Human Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) ELISA Kit
MBS459447-04 10x 96 Tests

Human Growth Arrest And DNA Damage Inducible Protein Alpha (GADD45a) ELISA Kit

Sign In for Pricing
View Details
UBE2D1 siRNA (Rat)
CRR5936-01 15 nmol

UBE2D1 siRNA (Rat)

Sign In for Pricing
View Details
UBE2D1 siRNA (Rat)
CRR5936-02 30 nmol

UBE2D1 siRNA (Rat)

Sign In for Pricing
View Details