Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prochlorothrix hollandica petE protein

This Prochlorothrix hollandica petE protein spans the amino acid sequence from region 35-131aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PetE, Plastocyanin

UniProt

P50057

Expression Region

35-131aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Prochlorothrix hollandica

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATVQIKMGTDKYAPLYEPKALSISAGDTVEFVMNKVGPHNVIFDKVPAGESAPALSNTKLAIAPGSFYSVTLGTPGTYSFYCTPHRGAGMVGTITVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Anti-Ovarian Antibody ELISA Kit
MBS731594-01 48 Well

Rat Anti-Ovarian Antibody ELISA Kit

Sign In for Pricing
View Details
Rat Anti-Ovarian Antibody ELISA Kit
MBS731594-02 96 Well

Rat Anti-Ovarian Antibody ELISA Kit

Sign In for Pricing
View Details
Rat Anti-Ovarian Antibody ELISA Kit
MBS731594-03 5x 96 Well

Rat Anti-Ovarian Antibody ELISA Kit

Sign In for Pricing
View Details
Rat Anti-Ovarian Antibody ELISA Kit
MBS731594-04 10x 96 Well

Rat Anti-Ovarian Antibody ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal HLA A Antibody (108-2C5) [mFluor Violet 500 SE]
NBP3-11420MFV500 0.1 mL

Mouse Monoclonal HLA A Antibody (108-2C5) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
STIRRER, Vortex Lateral Tumble, Servo Motor, High Speed and High Torque, Stand With Grip Mat For Tubes, Vials, and Bottles, Manual Control, RPM Readout on Control Unit LCD, 120/220 Volts, 60/50 Hz, CE Compliant
VP 708C5-7B 1 EACH

STIRRER, Vortex Lateral Tumble, Servo Motor, High Speed and High Torque, Stand With Grip Mat For Tubes, Vials, and Bottles, Manual Control, RPM Readout on Control Unit LCD, 120/220 Volts, 60/50 Hz, CE Compliant

Sign In for Pricing
View Details