Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prochlorothrix hollandica petE protein

This Prochlorothrix hollandica petE protein spans the amino acid sequence from region 35-131aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PetE, Plastocyanin

UniProt

P50057

Expression Region

35-131aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Prochlorothrix hollandica

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATVQIKMGTDKYAPLYEPKALSISAGDTVEFVMNKVGPHNVIFDKVPAGESAPALSNTKLAIAPGSFYSVTLGTPGTYSFYCTPHRGAGMVGTITVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-POFUT3 Antibody Picoband® APC Conjugated
A12931-1-APC 100 µg/Vial

Anti-POFUT3 Antibody Picoband® APC Conjugated

Sign In for Pricing
View Details
Compound TN12068
orb3178458-01 1 mg

Compound TN12068

Sign In for Pricing
View Details
Compound TN12068
orb3178458-02 2 mg

Compound TN12068

Sign In for Pricing
View Details
Compound TN12068
orb3178458-03 3 mg

Compound TN12068

Sign In for Pricing
View Details
Compound TN12068
orb3178458-04 4 mg

Compound TN12068

Sign In for Pricing
View Details
Compound TN12068
orb3178458-05 5 mg

Compound TN12068

Sign In for Pricing
View Details