Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect D7 protein

This Insect D7 protein spans the amino acid sequence from region 18-321aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein D7 Allergen, Aed a 2

UniProt

P18153

Expression Region

18-321aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYTVLDDALFKEHTDCVMKGIRYITKNNELDAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSNAGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKKQVYSKPAVQSQVMEIDGKQCPQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR137C Recombinant Protein Antigen
NBP1-85024PEP 0.1 mL

GPR137C Recombinant Protein Antigen

Sign In for Pricing
View Details
NALP3 Peptide
5447P 0.05 mg

NALP3 Peptide

Sign In for Pricing
View Details
ULK3, CT (Unc-51 Like Kinase 3, Serine/Threonine-protein Kinase ULK3)
303692 100 µg

ULK3, CT (Unc-51 Like Kinase 3, Serine/Threonine-protein Kinase ULK3)

Sign In for Pricing
View Details
Stac2 ORF Vector (Rat) (pORF)
45664016 1.0 µg DNA

Stac2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
1,4-Anhydro-2-deoxy-2-iodo-β-D-galactopyranose
GC8478-50mg 50 mg

1,4-Anhydro-2-deoxy-2-iodo-β-D-galactopyranose

Sign In for Pricing
View Details
Anti-NISCH antibody
STJ111485 100 µl

Anti-NISCH antibody

Sign In for Pricing
View Details