Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect D7 protein

This Insect D7 protein spans the amino acid sequence from region 18-321aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein D7 Allergen, Aed a 2

UniProt

P18153

Expression Region

18-321aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYTVLDDALFKEHTDCVMKGIRYITKNNELDAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSNAGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKKQVYSKPAVQSQVMEIDGKQCPQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RWDD3 Protein Vector (Mouse) (pPM-C-HA)
PV226304 500 ng

RWDD3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
SAP30L (NM_024632) Human Tagged ORF Clone
RC203405 10 µg

SAP30L (NM_024632) Human Tagged ORF Clone

Sign In for Pricing
View Details
Cathepsin L Rabbit pAb
E2251412 100 µL

Cathepsin L Rabbit pAb

Sign In for Pricing
View Details
Lentiviral mouse Pde6g shRNA (UAS) - Lentiviral mouse Pde6g shRNA (UAS, iRFP) (25)
GTR15233738 1 Vial

Lentiviral mouse Pde6g shRNA (UAS) - Lentiviral mouse Pde6g shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Newborn Calf Serum - Aseptically Filled - Heat Inactivated
abx810172-01 5 nmol

Newborn Calf Serum - Aseptically Filled - Heat Inactivated

Sign In for Pricing
View Details
Newborn Calf Serum - Aseptically Filled - Heat Inactivated
abx810172-02 10 nmol

Newborn Calf Serum - Aseptically Filled - Heat Inactivated

Sign In for Pricing
View Details