Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect D7 protein

This Insect D7 protein spans the amino acid sequence from region 18-321aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein D7 Allergen, Aed a 2

UniProt

P18153

Expression Region

18-321aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYTVLDDALFKEHTDCVMKGIRYITKNNELDAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSNAGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKKQVYSKPAVQSQVMEIDGKQCPQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vwa1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6430505 3x 1.0 µg

Vwa1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
PRM2 siRNA (Rat)
MBS8231163-01 15 nmol

PRM2 siRNA (Rat)

Sign In for Pricing
View Details
PRM2 siRNA (Rat)
MBS8231163-02 30 nmol

PRM2 siRNA (Rat)

Sign In for Pricing
View Details
PRM2 siRNA (Rat)
MBS8231163-03 5x 30 nmol

PRM2 siRNA (Rat)

Sign In for Pricing
View Details
Recombinant Neisseria Gonorrhoeae rpsU Protein (aa 1-70) (strain NCCP11945)
VAng-Wyb2391-50gEcoli 50 µg (E. coli)

Recombinant Neisseria Gonorrhoeae rpsU Protein (aa 1-70) (strain NCCP11945)

Sign In for Pricing
View Details
Immune Receptor Expressed On Myeloid Cells 1 (IREM1) Magnetic Fluorescence Assay Kit
MBS2157326-01 96 Tests

Immune Receptor Expressed On Myeloid Cells 1 (IREM1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details