Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human XI protein

This Human XI protein spans the amino acid sequence from region 532-699aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

COBA1_HUMAN, COL11A1, COLL6, Collagen alpha 1, Collagen alpha-1 (XI) chain, collagen XI alpha 1, collagen XI, alpha 1 polypeptide , collagen, type XI, alpha 1, STL2, STL3, XI chain precursor

UniProt

P12107

Expression Region

532-699aa

Tag

N-terminal GST-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal GST-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPMGLTGRPGPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF126 Antibody
MBS9524392-01 0.04 mL

RNF126 Antibody

Sign In for Pricing
View Details
RNF126 Antibody
MBS9524392-02 0.1 mL

RNF126 Antibody

Sign In for Pricing
View Details
RNF126 Antibody
MBS9524392-03 0.2 mL

RNF126 Antibody

Sign In for Pricing
View Details
RNF126 Antibody
MBS9524392-04 5x 0.2 mL

RNF126 Antibody

Sign In for Pricing
View Details
2-Amino-6-methylbenzoic acid methyl ester
18595-13-6 1 Each

2-Amino-6-methylbenzoic acid methyl ester

Sign In for Pricing
View Details
Anti-Human POLR3D Polyclonal Antibody
ARO-A19464-01 50 µg

Anti-Human POLR3D Polyclonal Antibody

Sign In for Pricing
View Details