Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mcpt4 protein

This Mouse Mcpt4 protein spans the amino acid sequence from region 21-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MMCP-4 MSMCP Myonase Serosal mast cell protease

UniProt

P21812

Expression Region

21-246aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Methoxypyrimidine
AAA93163 5 g

2-Methoxypyrimidine

Sign In for Pricing
View Details
Wap Protein Lysate (Rat) with C-HA Tag
50249036 100 µg

Wap Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
FOLR1 Recombinant Protein
OPCD03287-10UG 10 µg

FOLR1 Recombinant Protein

Sign In for Pricing
View Details
Human ARHGAP24 Protein Lysate
MBS137457-01 0.02 mg

Human ARHGAP24 Protein Lysate

Sign In for Pricing
View Details
Human ARHGAP24 Protein Lysate
MBS137457-02 5x 0.02 mg

Human ARHGAP24 Protein Lysate

Sign In for Pricing
View Details
pAWP78-PVCpnf_pvc13-antiHistoneNb Plasmid
PVT50520 2 µg

pAWP78-PVCpnf_pvc13-antiHistoneNb Plasmid

Sign In for Pricing
View Details