Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mcpt4 protein

This Mouse Mcpt4 protein spans the amino acid sequence from region 21-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MMCP-4 MSMCP Myonase Serosal mast cell protease

UniProt

P21812

Expression Region

21-246aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADORA1 293 Cell Lysate
409450 0.1 mg

ADORA1 293 Cell Lysate

Sign In for Pricing
View Details
DNPH1 Rabbit pAb
E45R23839N-50 50 µL

DNPH1 Rabbit pAb

Sign In for Pricing
View Details
L-Rhamnose Monohydrate
TRC-R315000-50G 50 g

L-Rhamnose Monohydrate

Sign In for Pricing
View Details
C7orf42-set siRNA/shRNA/RNAi Lentivector (Human)
14688091 4x 500 ng

C7orf42-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Anti-Phospho-E2A (T355) antibody
STJ91252 200 µl

Anti-Phospho-E2A (T355) antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SERPINB12 Antibody [Alexa Fluor 700]
NB100-93572AF700 0.1 mL

Rabbit Polyclonal SERPINB12 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details