Human MDC1 protein
This Human MDC1 protein spans the amino acid sequence from region 1892-2082aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Nuclear factor with BRCT domains 1
UniProt
Q14676
Expression Region
1892-2082aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Homo sapiens (Human)
Field of Research
Epigenetics & Chromatin
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
22.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
E.coli and Yeast N-terminal 6xHis-tagged Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
APKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15318340 1 Vial
Lentiviral human CCDC36 shRNA (UAS) - Lentiviral human CCDC36 shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details 
137863-FITC 100 µL
COL4A6 (Collagen Type VI alpha 2, Collagen alpha-6 (IV) Chain, CXDELq22.3, DELXq22.3, MGC88184) (FITC)
Sign In for Pricing
View Details 
F6401-32E 50 µg
Frizzled 7 (Frizzled-7, Frizzled (Drosophila) Homolog of 7, Frizzled Homolog 7, Fz 7, Fz-7, FZD7, FzE3, hFz7, Homolog of Drosophila Frizzled 7)
Sign In for Pricing
View Details