Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ube3a protein

This Mouse Ube3a protein spans the amino acid sequence from region 542-870aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Oncogenic protein-associated protein E6-AP

UniProt

O08759

Expression Region

542-870aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDEATKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGSVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRESVVIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Caffeoylquinic acid
MBS3613096-01 5 mg

1-Caffeoylquinic acid

Sign In for Pricing
View Details
1-Caffeoylquinic acid
MBS3613096-02 10 mg

1-Caffeoylquinic acid

Sign In for Pricing
View Details
1-Caffeoylquinic acid
MBS3613096-03 25 mg

1-Caffeoylquinic acid

Sign In for Pricing
View Details
1-Caffeoylquinic acid
MBS3613096-04 50 mg

1-Caffeoylquinic acid

Sign In for Pricing
View Details
1-Caffeoylquinic acid
MBS3613096-05 100 mg

1-Caffeoylquinic acid

Sign In for Pricing
View Details
1-Caffeoylquinic acid
MBS3613096-06 5x 100 mg

1-Caffeoylquinic acid

Sign In for Pricing
View Details