Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Allergen Pla a 1 protein

This Plant Allergen Pla a 1 protein spans the amino acid sequence from region 24-179aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pollen allergen Pla a 1 Allergen, Pla a 1

UniProt

Q8GT41

Expression Region

24-179aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

London plane tree

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADIVQGTCKKVAQRSPNVNYDFCVKSLGADPKSHTADLQGLGVISANLAIQHGSKIQTFIGRILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADFKSKDYASANVKMSAALDDSVTCEDGFKEKKGIVSPVTKENKDYVQLTAISLAITKLLGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LKB1 (STK11) pSer428 Rabbit Polyclonal Antibody
AP20913PU-N 100 µg

LKB1 (STK11) pSer428 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-FAM38A/PIEZO1 Antibody [2-10]
M1005-2TR 20 µL

Anti-FAM38A/PIEZO1 Antibody [2-10]

Sign In for Pricing
View Details
Cyclin B1 Rabbit Polyclonal Antibody
R1308-13 100 µL

Cyclin B1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3526), CF740 conjugate, 0.1mg/mL
BNC743526-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3526), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rps13 Mouse Gene Knockout Kit (CRISPR)
KN515080 1 Kit

Rps13 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
O-TMS Dehydro-o,p’-Dicofol
TRC-T947625-5MG 5 mg

O-TMS Dehydro-o,p’-Dicofol

Sign In for Pricing
View Details