Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parasite MSA2 protein

This Parasite MSA2 protein spans the amino acid sequence from region 109-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

45KDA merozoite surface antigen

UniProt

P50498

Expression Region

109-246aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Plasmodium falciparum (isolate 3D7)

Field of Research

Developmental Biology, Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Fumarylacetoacetate Hydrolase (FAH)
FY-AB40234-01 1 mL

Anti-Fumarylacetoacetate Hydrolase (FAH)

Sign In for Pricing
View Details
Anti-Fumarylacetoacetate Hydrolase (FAH)
FY-AB40234-02 100 µL

Anti-Fumarylacetoacetate Hydrolase (FAH)

Sign In for Pricing
View Details
Anti-Fumarylacetoacetate Hydrolase (FAH)
FY-AB40234-03 200 µL

Anti-Fumarylacetoacetate Hydrolase (FAH)

Sign In for Pricing
View Details
PCYT1A, CT (PCYT1A, CTPCT, PCYT1, Choline-phosphate cytidylyltransferase A, CCT-alpha, CTP:phosphocholine cytidylyltransferase A, Phosphorylcholine transferase A) (MaxLight 750)
MBS6331922-01 0.1 mL

PCYT1A, CT (PCYT1A, CTPCT, PCYT1, Choline-phosphate cytidylyltransferase A, CCT-alpha, CTP:phosphocholine cytidylyltransferase A, Phosphorylcholine transferase A) (MaxLight 750)

Sign In for Pricing
View Details
PCYT1A, CT (PCYT1A, CTPCT, PCYT1, Choline-phosphate cytidylyltransferase A, CCT-alpha, CTP:phosphocholine cytidylyltransferase A, Phosphorylcholine transferase A) (MaxLight 750)
MBS6331922-02 5x 0.1 mL

PCYT1A, CT (PCYT1A, CTPCT, PCYT1, Choline-phosphate cytidylyltransferase A, CCT-alpha, CTP:phosphocholine cytidylyltransferase A, Phosphorylcholine transferase A) (MaxLight 750)

Sign In for Pricing
View Details
Anti-MC2 receptor/MC2R Antibody Picoband® (Dylight594 Conjugate)
A02306-1-Dylight594 100 µg

Anti-MC2 receptor/MC2R Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details