Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ANGPT2 protein

This Human ANGPT2 protein spans the amino acid sequence from region 19-485aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AGPT 2, Agpt2, ANG 2, ANG-2, ANG2, Angiopoietin 2a, Angiopoietin 2B, Angiopoietin-2, Angiopoietin2, ANGP2_HUMAN, ANGPT 2, Angpt2, Tie2 ligand

UniProt

O15123

Expression Region

19-485aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Teneurin-1, ODZ1 ELISA KIT
ELI-52118h 96 Tests

Human Teneurin-1, ODZ1 ELISA KIT

Sign In for Pricing
View Details
Harmonin Antibody
DF13054-01 100 µL

Harmonin Antibody

Sign In for Pricing
View Details
Harmonin Antibody
DF13054-02 200 µL

Harmonin Antibody

Sign In for Pricing
View Details
IDN3 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-15541R-BF680 100 µL

IDN3 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Human IL36G 152 a.a. Protein
orb426605-01 2 µg

Human IL36G 152 a.a. Protein

Sign In for Pricing
View Details
Human IL36G 152 a.a. Protein
orb426605-02 10 µg

Human IL36G 152 a.a. Protein

Sign In for Pricing
View Details