Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pig VEGF protein

This Pig VEGF protein spans the amino acid sequence from region 27-190aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vascular permeability factor , VPF

UniProt

P49151

Expression Region

27-190aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Cardiovascular Research; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APMAEGDQKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNAI2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV710465 1.0 µg DNA

GNAI2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
BMP5 3'UTR Luciferase Stable Cell Line
TU001819 1.0 mL

BMP5 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TUBB6 antibody
70R-10057 100 µL

TUBB6 antibody

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum Protein CysZ (cysZ)
MBS7013584-01 0.02 mg

Recombinant Salmonella gallinarum Protein CysZ (cysZ)

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum Protein CysZ (cysZ)
MBS7013584-02 0.1 mg

Recombinant Salmonella gallinarum Protein CysZ (cysZ)

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum Protein CysZ (cysZ)
MBS7013584-03 5x 0.1 mg

Recombinant Salmonella gallinarum Protein CysZ (cysZ)

Sign In for Pricing
View Details