Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pig VEGF protein

This Pig VEGF protein spans the amino acid sequence from region 27-190aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vascular permeability factor , VPF

UniProt

P49151

Expression Region

27-190aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Cardiovascular Research; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APMAEGDQKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant other Protein-A/G Protein, His, E.coli-100mg
QP13163-100mg 100mg

Recombinant other Protein-A/G Protein, His, E.coli-100mg

Sign In for Pricing
View Details
Lentiviral human VPS41 shRNA (UAS) - Lentiviral human VPS41 shRNA (UAS) plasmid
GTR15141043 1 Vial

Lentiviral human VPS41 shRNA (UAS) - Lentiviral human VPS41 shRNA (UAS) plasmid

Sign In for Pricing
View Details
44-Thiobisbenzeneamine
S-4475 1 mL

44-Thiobisbenzeneamine

Sign In for Pricing
View Details
GFOD1 Human shRNA Plasmid Kit (Locus ID 54438)
TL304360 1 Kit

GFOD1 Human shRNA Plasmid Kit (Locus ID 54438)

Sign In for Pricing
View Details
Recombinant human Fumarase/FH protein
FMR0905-100 100 µg

Recombinant human Fumarase/FH protein

Sign In for Pricing
View Details
Mouse SPSB1 shRNA Plasmid
abx978285-01 150 µg

Mouse SPSB1 shRNA Plasmid

Sign In for Pricing
View Details