Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ccr5 protein

This Mouse Ccr5 protein spans the amino acid sequence from region 263-354aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MIP-1 alpha receptor CD_antigen, CD195

UniProt

P51682

Expression Region

263-354aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEFFGLNNCSSSNRLDQAMQATETLGMTHCCLNPVIYAFVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSVYTRSTGEHEVSTGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EVI2B Protein Vector (Mouse) (pPM-C-His)
PV176565 500 ng

EVI2B Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Human WIPF2 Pre-designed siRNA Set A
SI018252A 1 Each

Human WIPF2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
FTLP2 Recombinant Protein (Human)
RP059736 100 µg

FTLP2 Recombinant Protein (Human)

Sign In for Pricing
View Details
Anti-Zebrafish NDR2 Antibody Picoband® HRP Conjugated
AZP87358-HRP 100 µg/Vial

Anti-Zebrafish NDR2 Antibody Picoband® HRP Conjugated

Sign In for Pricing
View Details
Anti-Acidic Cytokeratin Mouse mAb
GB122051-100 100 μL

Anti-Acidic Cytokeratin Mouse mAb

Sign In for Pricing
View Details
Histone H4 (Acetyl K12) Rabbit Polyclonal Antibody (AP)
orb898815 100 µL

Histone H4 (Acetyl K12) Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details