Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli mutT protein

This E. coli mutT protein spans the amino acid sequence from region 1-129aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

7,8-dihydro-8-oxoguanine-triphosphatase Mutator protein MutT dGTP pyrophosphohydrolase

UniProt

P08337

Expression Region

1-129aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cytochrome P450 1B1 (CYP1B1) ELISA kit
GTR10411910 96 Well

Rat Cytochrome P450 1B1 (CYP1B1) ELISA kit

Sign In for Pricing
View Details
Human IL27 / Interleukin-27 subunit alpha Recombinant Protein
R0385h 1 Each

Human IL27 / Interleukin-27 subunit alpha Recombinant Protein

Sign In for Pricing
View Details
BAG3 Rabbit pAb, IRDye 800CW conjugated
orb2827851 100 µL

BAG3 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Human SBDP 150 ELISA Kit
orb564785-01 48 Tests

Human SBDP 150 ELISA Kit

Sign In for Pricing
View Details
Human SBDP 150 ELISA Kit
orb564785-02 96 Tests

Human SBDP 150 ELISA Kit

Sign In for Pricing
View Details
Human CWC27 siRNA
abx901344-01 15 nmol

Human CWC27 siRNA

Sign In for Pricing
View Details