Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PSPN protein (Active)

This Human PSPN protein (Active) spans the amino acid sequence from region 61-156aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

PSP

UniProt

O60542

Expression Region

61-156aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TT medullary thyroid cancer cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

10.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

ALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyanine5 alkyne
558807 5.0mg

Cyanine5 alkyne

Sign In for Pricing
View Details
Camel Tetraspanin 4 (TSPAN4) ELISA Kit
MBS9942005 Inquire

Camel Tetraspanin 4 (TSPAN4) ELISA Kit

Sign In for Pricing
View Details
Anti-Chapsyn-110 Antibody
orb1147986 100 µg

Anti-Chapsyn-110 Antibody

Sign In for Pricing
View Details
TLE3 Blocking Peptide
MBS9620942-01 1 mg

TLE3 Blocking Peptide

Sign In for Pricing
View Details
TLE3 Blocking Peptide
MBS9620942-02 5x 1 mg

TLE3 Blocking Peptide

Sign In for Pricing
View Details
CASR, ID (CASR, GPRC2A, PCAR1, Extracellular calcium-sensing receptor, Parathyroid cell calcium-sensing receptor) (FITC) discontinued
033221-FITC 200 µL

CASR, ID (CASR, GPRC2A, PCAR1, Extracellular calcium-sensing receptor, Parathyroid cell calcium-sensing receptor) (FITC) discontinued

Sign In for Pricing
View Details