Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PSPN protein (Active)

This Human PSPN protein (Active) spans the amino acid sequence from region 61-156aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

PSP

UniProt

O60542

Expression Region

61-156aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TT medullary thyroid cancer cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

10.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

ALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAI14 Rabbit Polyclonal Antibody (BF555)
orb2466327 100 µL

RAI14 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
KRTAP3-2 siRNA (h)
sc-94040 10 µM

KRTAP3-2 siRNA (h)

Sign In for Pricing
View Details
NKRF (NF-kappa-B-repressing Factor, NFkB-repressing Factor, Transcription Factor NRF, ITBA4 Protein, NRF, ITBA4) (AP) discontinued
130394-AP 100 µL

NKRF (NF-kappa-B-repressing Factor, NFkB-repressing Factor, Transcription Factor NRF, ITBA4 Protein, NRF, ITBA4) (AP) discontinued

Sign In for Pricing
View Details
TRNAK18 AAV Vector (Human) (CMV)
48114101 1 µg

TRNAK18 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Recombinant Human DDX1 Protein
E30P5651 20 µg

Recombinant Human DDX1 Protein

Sign In for Pricing
View Details
1700067K01Rik Protein Lysate (Mouse) with C-HA Tag
10250034 100 µg

1700067K01Rik Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details