Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNR6 protein (Active)

This Human TNR6 protein (Active) spans the amino acid sequence from region 17-173aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Apo-1 antigen, FASLG receptor, CD antigen CD95

UniProt

P25445

Expression Region

17-173aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the cytotoxicity of Jurkat cells is between 10-15 μg/ml in the presence of 2 ng/ml of rHuFas Ligand.

Form

Lyophilized powder

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

RLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat NECTIN1 ELISA Matched Antibody Pair Set [ABP-Q-04-283]
ABP-Q-04-283 5 Plates

Rat NECTIN1 ELISA Matched Antibody Pair Set [ABP-Q-04-283]

Sign In for Pricing
View Details
MAGED2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
27941154 3x 1.0 µg DNA

MAGED2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Rabbit anti-Vitreoscilla stercoraria vhb Polyclonal Antibody
MBS7164367 Inquire

Rabbit anti-Vitreoscilla stercoraria vhb Polyclonal Antibody

Sign In for Pricing
View Details
NTN5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV650881 1.0 µg DNA

NTN5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SNX5 Human Pre-designed siRNA Set A
HY-RS13544 1 Set

SNX5 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
CD10 Antibody
orb432843 0.1 mL

CD10 Antibody

Sign In for Pricing
View Details