Human TNR12 protein (Active)
This Human TNR12 protein (Active) spans the amino acid sequence from region 28-80aa. Purity: > 95% as determined by SDS-PAGE and HPLC.
Product Specifications
Product Name Alternative
Fibroblast growth factor-inducible immediate-early response protein 14, Tweak-receptor, TweakR, CD antigen CD266
UniProt
Q9NP84
Expression Region
28-80aa
Tag
Tag-Free
Source
E.Coli
Origin
Homo sapiens (Human)
Field of Research
Cancer Biology
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
> 95% as determined by SDS-PAGE and HPLC.
Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by inhibiting TWEAK- dependent proliferation of human umbilical vein endothelial cells (HUVEC) is less than 30 ng/ml, corresponding to a specific activity of > 3.3 x 10 ^ 4 IU/mg, in the presence of 15 ng/ml of rHuTWEAK.
Form
Lyophilized powder
Molecular Weight
5.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, pH 7.4
AA Sequence
EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
L01034-1 2 mL (1 mL Settled Beads)
MonoRab™ Anti-VHH Affinity Magnetic Beads
Sign In for Pricing
View Details 
GTR15224829 1 Vial
Lentiviral mouse Scamp5 shRNA (UAS) - Lentiviral mouse Scamp5 shRNA (UAS, GFP) (100)
Sign In for Pricing
View Details MBS9329176-01 48 Well
Bovine Transmembrane protein with metallophosphoesterase domain, TMPPE ELISA Kit
Sign In for Pricing
View Details